Description | Vitamin D3 receptor A |
---|---|
Organism | Danio rerio |
Chain | A |
Length | 241 |
Binding Area (Å2) | 520.01 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 6.18 |
Sequence | HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLEHLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVSX |
Description | Nuclear receptor coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 10 |
Binding Area (Å2) | 602.81 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1313.60 |
Aromaticity | 0.00 |
Instability | 95.31 |
Isoelectric Point | 12.01 |
Sequence | RHKILHRLLQ |
Is the complex classified in the same cluster?