Description | Nuclear receptor ROR-gamma |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 246 |
Binding Area (Å2) | 458.40 |
Molecular Weight | - |
Aromaticity | 0.10 |
Instability | - |
Isoelectric Point | 8.26 |
Sequence | PYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSX |
Description | co-activator peptide |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 8 |
Binding Area (Å2) | 529.50 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1020.27 |
Aromaticity | 0.00 |
Instability | 62.96 |
Isoelectric Point | 11.00 |
Sequence | KILHRLLQ |
Is the complex classified in the same cluster?