Description | Nuclear receptor ROR-gamma |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 246 |
Binding Area (Å2) | 464.35 |
Molecular Weight | - |
Aromaticity | 0.10 |
Instability | - |
Isoelectric Point | 8.19 |
Sequence | YASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLSKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTX |
Description | Nuclear receptor-interacting protein 1 |
---|---|
Organism | Homo sapiens |
Chain | S |
Length | 9 |
Binding Area (Å2) | 541.74 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1007.23 |
Aromaticity | 0.00 |
Instability | 45.11 |
Isoelectric Point | 6.40 |
Sequence | TLLQLLLGH |
Is the complex classified in the same cluster?