Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 243 |
Binding Area (Å2) | 424.58 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.05 |
Sequence | NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 10 |
Binding Area (Å2) | 509.03 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1222.44 |
Aromaticity | 0.00 |
Instability | 90.89 |
Isoelectric Point | 8.75 |
Sequence | KILHRLLQDS |
Is the complex classified in the same cluster?