Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 242 |
Binding Area (Å2) | 497.52 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.04 |
Sequence | SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 11 |
Binding Area (Å2) | 553.74 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1309.51 |
Aromaticity | 0.00 |
Instability | 101.05 |
Isoelectric Point | 8.75 |
Sequence | KILHRLLQDSS |
Is the complex classified in the same cluster?