Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 241 |
Binding Area (Å2) | 471.40 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 5.99 |
Sequence | LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAXX |
Description | Nuclear receptor-interacting peptide |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 9 |
Binding Area (Å2) | 547.53 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1135.36 |
Aromaticity | 0.00 |
Instability | 78.48 |
Isoelectric Point | 8.76 |
Sequence | KILHRLLQD |
Is the complex classified in the same cluster?