Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 244 |
Binding Area (Å2) | 489.72 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.17 |
Sequence | KNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 11 |
Binding Area (Å2) | 539.41 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1359.58 |
Aromaticity | 0.00 |
Instability | 105.06 |
Isoelectric Point | 8.76 |
Sequence | HKILHRLLQDS |
Is the complex classified in the same cluster?