Description | Retinoic acid receptor beta |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 240 |
Binding Area (Å2) | 429.75 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 5.89 |
Sequence | YEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENX |
Description | Nuclear receptor coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 8 |
Binding Area (Å2) | 511.63 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1020.27 |
Aromaticity | 0.00 |
Instability | 62.96 |
Isoelectric Point | 11.00 |
Sequence | KILHRLLQ |
Is the complex classified in the same cluster?