Description | Retinoic acid receptor beta |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 250 |
Binding Area (Å2) | 487.96 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.02 |
Sequence | GLVPRGSHMESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMMEX |
Description | Nuclear receptor coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | F |
Length | 10 |
Binding Area (Å2) | 516.10 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1286.53 |
Aromaticity | 0.00 |
Instability | 95.31 |
Isoelectric Point | 8.76 |
Sequence | HKILHRLLQE |
Is the complex classified in the same cluster?