Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 244 |
Binding Area (Å2) | 487.21 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.09 |
Sequence | SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAPX |
Description | Nuclear receptor-interacting peptide |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 9 |
Binding Area (Å2) | 532.85 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1135.36 |
Aromaticity | 0.00 |
Instability | 78.48 |
Isoelectric Point | 8.76 |
Sequence | KILHRLLQD |
Is the complex classified in the same cluster?