Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 243 |
Binding Area (Å2) | 491.68 |
Molecular Weight | - |
Aromaticity | 0.05 |
Instability | - |
Isoelectric Point | 6.04 |
Sequence | SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Mus musculus |
Chain | D |
Length | 9 |
Binding Area (Å2) | 549.28 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1135.36 |
Aromaticity | 0.00 |
Instability | 78.48 |
Isoelectric Point | 8.76 |
Sequence | KILHRLLQD |
Is the complex classified in the same cluster?