Description | Vitamin D3 receptor A |
---|---|
Organism | Danio rerio |
Chain | A |
Length | 240 |
Binding Area (Å2) | 515.89 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 5.99 |
Sequence | HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVSX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 10 |
Binding Area (Å2) | 603.52 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1285.58 |
Aromaticity | 0.00 |
Instability | 76.05 |
Isoelectric Point | 11.17 |
Sequence | KHKILHRLLQ |
Is the complex classified in the same cluster?