Description | Vitamin D3 receptor |
---|---|
Organism | Rattus norvegicus |
Chain | A |
Length | 240 |
Binding Area (Å2) | 547.86 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 6.21 |
Sequence | RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGX |
Description | Mediator of RNA polymerase II transcription subunit 1 |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 11 |
Binding Area (Å2) | 582.66 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1325.60 |
Aromaticity | 0.00 |
Instability | -8.10 |
Isoelectric Point | 6.75 |
Sequence | NHPMLMNLLKD |
Is the complex classified in the same cluster?