Description | Vitamin D3 receptor,Vitamin D3 receptor |
---|---|
Organism | Rattus norvegicus |
Chain | A |
Length | 241 |
Binding Area (Å2) | 510.33 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 5.92 |
Sequence | KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEX |
Description | Coactivator peptide drip from cDNA FLJ50196, highly similar to Peroxisome proliferator-activated receptor-binding protein |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 10 |
Binding Area (Å2) | 517.84 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1210.51 |
Aromaticity | 0.00 |
Instability | -9.91 |
Isoelectric Point | 8.76 |
Sequence | NHPMLMNLLK |
Is the complex classified in the same cluster?