Description | Vitamin D3 receptor A |
---|---|
Organism | Danio rerio |
Chain | C |
Length | 241 |
Binding Area (Å2) | 514.27 |
Molecular Weight | - |
Aromaticity | 0.07 |
Instability | - |
Isoelectric Point | 6.05 |
Sequence | MLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVSXX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 10 |
Binding Area (Å2) | 601.28 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1214.46 |
Aromaticity | 0.00 |
Instability | 76.05 |
Isoelectric Point | 11.00 |
Sequence | GHKILHRLLQ |
Is the complex classified in the same cluster?