Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 226 |
Binding Area (Å2) | 396.21 |
Molecular Weight | 25794.22 |
Aromaticity | 0.06 |
Instability | 36.48 |
Isoelectric Point | 6.31 |
Sequence | LALSLTADQMVSALLDAEPPILYSEYDPTRPSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNLYGLLLEMLDAHR |
Description | Glucocorticoid receptor-interacting protein 1 NR box II peptide |
---|---|
Organism | synthetic construct |
Chain | C |
Length | 6 |
Binding Area (Å2) | 464.48 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 763.97 |
Aromaticity | 0.00 |
Instability | 40.43 |
Isoelectric Point | 9.76 |
Sequence | ILHRLL |
Is the complex classified in the same cluster?