Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 243 |
Binding Area (Å2) | 498.83 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.10 |
Sequence | LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Mus musculus |
Chain | D |
Length | 11 |
Binding Area (Å2) | 567.28 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1400.67 |
Aromaticity | 0.00 |
Instability | 87.55 |
Isoelectric Point | 9.99 |
Sequence | KHKILHRLLQD |
Is the complex classified in the same cluster?