Description | Retinoic acid receptor beta |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 240 |
Binding Area (Å2) | 474.90 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 5.88 |
Sequence | SYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMMEX |
Description | Nuclear receptor coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | F |
Length | 9 |
Binding Area (Å2) | 557.70 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1157.41 |
Aromaticity | 0.00 |
Instability | 83.39 |
Isoelectric Point | 11.00 |
Sequence | HKILHRLLQ |
Is the complex classified in the same cluster?