Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 226 |
Binding Area (Å2) | 435.58 |
Molecular Weight | 25828.32 |
Aromaticity | 0.06 |
Instability | 34.95 |
Isoelectric Point | 6.31 |
Sequence | LALSLTADQMVSALLDAEPPILYSEYFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVPLYGLLLEMLDAHR |
Description | Glucocorticoid receptor-interacting protein 1 NR box II peptide |
---|---|
Organism | synthetic construct |
Chain | D |
Length | 8 |
Binding Area (Å2) | 512.08 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1020.27 |
Aromaticity | 0.00 |
Instability | 62.96 |
Isoelectric Point | 11.00 |
Sequence | KILHRLLQ |
Is the complex classified in the same cluster?