Description | Estrogen receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 246 |
Binding Area (Å2) | 484.72 |
Molecular Weight | - |
Aromaticity | 0.06 |
Instability | - |
Isoelectric Point | 6.04 |
Sequence | SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 10 |
Binding Area (Å2) | 543.35 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1272.50 |
Aromaticity | 0.00 |
Instability | 95.31 |
Isoelectric Point | 8.76 |
Sequence | HKILHRLLQD |
Is the complex classified in the same cluster?