Description | Peroxisome proliferator-activated receptor alpha |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 247 |
Binding Area (Å2) | 527.64 |
Molecular Weight | - |
Aromaticity | 0.09 |
Instability | - |
Isoelectric Point | 5.77 |
Sequence | DLKSLAKRIYEAYLKNFNMNKVKARVILSPFVIHDMETLCMAEKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMYX |
Description | Peptide motif 5 of Nuclear receptor coactivator 1 |
---|---|
Organism | Homo sapiens |
Chain | Z |
Length | 8 |
Binding Area (Å2) | 618.70 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1055.27 |
Aromaticity | 0.13 |
Instability | 23.40 |
Isoelectric Point | 8.75 |
Sequence | HQLLRYLL |
Is the complex classified in the same cluster?