Description | Glucocorticoid receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 246 |
Binding Area (Å2) | 531.45 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 6.24 |
Sequence | LPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMYLMAFALGWRSYRQANLLCFAPDLIINEQRMTLPGMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 10 |
Binding Area (Å2) | 584.75 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1218.44 |
Aromaticity | 0.10 |
Instability | 12.23 |
Isoelectric Point | 8.59 |
Sequence | NALLRYLLDK |
Is the complex classified in the same cluster?