Description | Androgen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 242 |
Binding Area (Å2) | 424.97 |
Molecular Weight | - |
Aromaticity | 0.12 |
Instability | - |
Isoelectric Point | 8.11 |
Sequence | PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIASCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTX |
Description | co-regulator peptide |
---|---|
Organism | synthetic construct |
Chain | B |
Length | 8 |
Binding Area (Å2) | 538.84 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 994.06 |
Aromaticity | 0.38 |
Instability | 28.21 |
Isoelectric Point | 8.31 |
Sequence | SAFSRYYT |
Is the complex classified in the same cluster?