Description | Glucocorticoid receptor |
---|---|
Organism | Mus musculus |
Chain | A |
Length | 254 |
Binding Area (Å2) | 511.40 |
Molecular Weight | - |
Aromaticity | 0.10 |
Instability | - |
Isoelectric Point | 6.90 |
Sequence | MVPAALPQLTPTLVSLLEVIEPEVLYAGPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQKX |
Description | Nuclear receptor coactivator 2 peptide |
---|---|
Organism | Mus musculus |
Chain | B |
Length | 10 |
Binding Area (Å2) | 563.92 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1219.39 |
Aromaticity | 0.10 |
Instability | 20.72 |
Isoelectric Point | 4.67 |
Sequence | ENALLRYLLD |
Is the complex classified in the same cluster?