Description | Glucocorticoid receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 249 |
Binding Area (Å2) | 545.44 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 6.26 |
Sequence | PQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMYLMAFALGWRSYRQNLLCFAPDLIINEQRMTLPGMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQX |
Description | Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | H |
Length | 11 |
Binding Area (Å2) | 619.84 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1347.56 |
Aromaticity | 0.09 |
Instability | 12.03 |
Isoelectric Point | 6.17 |
Sequence | ENALLRYLLDK |
Is the complex classified in the same cluster?