Description | Androgen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 242 |
Binding Area (Å2) | 403.95 |
Molecular Weight | - |
Aromaticity | 0.12 |
Instability | - |
Isoelectric Point | 8.11 |
Sequence | PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIASCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTX |
Description | co-regulator peptide |
---|---|
Organism | synthetic construct |
Chain | B |
Length | 8 |
Binding Area (Å2) | 523.15 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 924.01 |
Aromaticity | 0.25 |
Instability | -1.86 |
Isoelectric Point | 5.52 |
Sequence | GAFQNLFQ |
Is the complex classified in the same cluster?