Description | Androgen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 243 |
Binding Area (Å2) | 390.38 |
Molecular Weight | - |
Aromaticity | 0.12 |
Instability | - |
Isoelectric Point | 8.11 |
Sequence | PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIASCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQX |
Description | co-regulator peptide |
---|---|
Organism | - |
Chain | B |
Length | 9 |
Binding Area (Å2) | 503.23 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1100.23 |
Aromaticity | 0.22 |
Instability | 20.86 |
Isoelectric Point | 10.83 |
Sequence | SAFSRLYTR |
Is the complex classified in the same cluster?