Description | Androgen receptor |
---|---|
Organism | Pan troglodytes |
Chain | A |
Length | 251 |
Binding Area (Å2) | 410.05 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 8.94 |
Sequence | QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTXX |
Description | WxxVW motif peptide |
---|---|
Organism | - |
Chain | B |
Length | 9 |
Binding Area (Å2) | 497.99 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1163.20 |
Aromaticity | 0.22 |
Instability | 77.23 |
Isoelectric Point | 4.27 |
Sequence | SRWAEVWDD |
Is the complex classified in the same cluster?