Description | Androgen receptor |
---|---|
Organism | Mus musculus |
Chain | A |
Length | 250 |
Binding Area (Å2) | 437.09 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 8.97 |
Sequence | PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTXX |
Description | Coactivator peptide |
---|---|
Organism | synthetic construct |
Chain | B |
Length | 10 |
Binding Area (Å2) | 503.60 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1263.44 |
Aromaticity | 0.10 |
Instability | 12.23 |
Isoelectric Point | 4.68 |
Sequence | LLRYLLDKDD |
Is the complex classified in the same cluster?