Description | Bile acid receptor |
---|---|
Organism | Homo sapiens |
Chain | C |
Length | 211 |
Binding Area (Å2) | 396.07 |
Molecular Weight | - |
Aromaticity | 0.09 |
Instability | - |
Isoelectric Point | 5.03 |
Sequence | TPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLFTPLLCEIWDVX |
Description | Peptide from Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | D |
Length | 8 |
Binding Area (Å2) | 515.65 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 976.17 |
Aromaticity | 0.13 |
Instability | 23.40 |
Isoelectric Point | 6.13 |
Sequence | ALLRYLLD |
Is the complex classified in the same cluster?