Description | Bile acid receptor |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 228 |
Binding Area (Å2) | 480.92 |
Molecular Weight | - |
Aromaticity | 0.08 |
Instability | - |
Isoelectric Point | 5.48 |
Sequence | LTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVX |
Description | Peptide from Nuclear receptor coactivator 2 |
---|---|
Organism | Homo sapiens |
Chain | E |
Length | 10 |
Binding Area (Å2) | 562.05 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1261.47 |
Aromaticity | 0.10 |
Instability | 20.72 |
Isoelectric Point | 4.67 |
Sequence | ENLLLRYLLD |
Is the complex classified in the same cluster?