Description | Androgen receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 244 |
Binding Area (Å2) | 502.27 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 8.11 |
Sequence | PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIAPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTX |
Description | co-regulator peptide |
---|---|
Organism | synthetic construct |
Chain | B |
Length | 8 |
Binding Area (Å2) | 578.02 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1061.10 |
Aromaticity | 0.38 |
Instability | 22.21 |
Isoelectric Point | 5.55 |
Sequence | SSFRDWYT |
Is the complex classified in the same cluster?