Description | Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily |
---|---|
Organism | Strongyloides stercoralis |
Chain | A |
Length | 235 |
Binding Area (Å2) | 444.01 |
Molecular Weight | - |
Aromaticity | 0.09 |
Instability | - |
Isoelectric Point | 6.74 |
Sequence | YTLSEKDLKELDSIRDSFQCNEPLDNDQQASTLAKKEHNPTDILNVDITRRLVKAKRLGAFNEISEAGKFSLLKGGIELTIRGVTVFNADKGVWQTPVDGHSQISFNFDKLRPDIKDTQKKGFLHFFNLLHSDVRKNDLAIDIIVLVLFDSKREGLVSQQDKETVEKLHRNYESLLHRYLYSIHKEEAEQRFASIPKALVALRKVAENAVTLFLGAGNTTEAASLPKEFFATNYX |
Description | SRC1 |
---|---|
Organism | Homo sapiens |
Chain | B |
Length | 10 |
Binding Area (Å2) | 494.62 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1172.37 |
Aromaticity | 0.00 |
Instability | 80.12 |
Isoelectric Point | 6.22 |
Sequence | KSLLQQLLTE |
Is the complex classified in the same cluster?