Description | Glucocorticoid receptor |
---|---|
Organism | Homo sapiens |
Chain | A |
Length | 246 |
Binding Area (Å2) | 495.35 |
Molecular Weight | - |
Aromaticity | 0.11 |
Instability | - |
Isoelectric Point | 6.26 |
Sequence | PQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMYLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPGMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQKXX |
Description | D30 peptide |
---|---|
Organism | - |
Chain | B |
Length | 10 |
Binding Area (Å2) | 609.08 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 1263.46 |
Aromaticity | 0.10 |
Instability | 71.20 |
Isoelectric Point | 4.85 |
Sequence | SSRLWELLME |
Is the complex classified in the same cluster?