| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | J |
| Length | 276 |
| Binding Area (Å2) | 717.25 |
| Molecular Weight | 32047.36 |
| Aromaticity | 0.12 |
| Instability | 41.81 |
| Isoelectric Point | 5.58 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP |
| Description | GAP50 peptide |
|---|---|
| Organism | Plasmodium berghei |
| Chain | L |
| Length | 9 |
| Binding Area (Å2) | 1178.11 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1049.22 |
| Aromaticity | 0.11 |
| Instability | 30.29 |
| Isoelectric Point | 8.31 |
| Sequence | SQLLNAKYL |
Is the complex classified in the same cluster?