| Description | Murine class I major histocompatibility complex H-2Kb |
|---|---|
| Organism | Mus musculus |
| Chain | C |
| Length | 272 |
| Binding Area (Å2) | 677.20 |
| Molecular Weight | - |
| Aromaticity | 0.12 |
| Instability | - |
| Isoelectric Point | 5.57 |
| Sequence | GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLGEELMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEX |
| Description | Pre-glycoprotein polyprotein GP complex |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | F |
| Length | 8 |
| Binding Area (Å2) | 1035.10 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 916.05 |
| Aromaticity | 0.25 |
| Instability | -19.46 |
| Isoelectric Point | 5.57 |
| Sequence | AVYNFATM |
Is the complex classified in the same cluster?