| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | A |
| Length | 262 |
| Binding Area (Å2) | 683.27 |
| Molecular Weight | 30594.71 |
| Aromaticity | 0.13 |
| Instability | 41.11 |
| Isoelectric Point | 5.59 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE |
| Description | Pre-glycoprotein polyprotein GP complex |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | C |
| Length | 9 |
| Binding Area (Å2) | 1132.79 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 952.13 |
| Aromaticity | 0.11 |
| Instability | -7.81 |
| Isoelectric Point | 8.75 |
| Sequence | KAVANFATM |
Is the complex classified in the same cluster?