| Description | Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN) |
|---|---|
| Organism | Rattus norvegicus |
| Chain | A |
| Length | 276 |
| Binding Area (Å2) | 668.34 |
| Molecular Weight | 31904.05 |
| Aromaticity | 0.12 |
| Instability | 39.86 |
| Isoelectric Point | 5.32 |
| Sequence | GSHSLRYFDIAVSRPGLGEPRYISVGYVDDTEFARYDSDAENRRYQPRARWMEREGPEYWERNTPIYKGKEQTFRVNLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYEQFAYDGRDYIALNEDLKTWTAADFAARISRNKLERDGFADLHRAYLEGECVESLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEP |
| Description | peptide NPR |
|---|---|
| Organism | Rattus norvegicus |
| Chain | P |
| Length | 9 |
| Binding Area (Å2) | 1029.55 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1013.21 |
| Aromaticity | 0.00 |
| Instability | -11.07 |
| Isoelectric Point | 9.75 |
| Sequence | NPRAMQALL |
Is the complex classified in the same cluster?