| Description | H-2 class I histocompatibility antigen, K-D alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | A |
| Length | 275 |
| Binding Area (Å2) | 760.96 |
| Molecular Weight | 32123.42 |
| Aromaticity | 0.13 |
| Instability | 38.40 |
| Isoelectric Point | 5.67 |
| Sequence | PHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP |
| Description | Peptide (P9) of Mtb85B (Mycobacterium tuberculosis) YQSGLSIVM |
|---|---|
| Organism | Mycobacterium tuberculosis |
| Chain | P |
| Length | 9 |
| Binding Area (Å2) | 1099.73 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 997.17 |
| Aromaticity | 0.11 |
| Instability | 48.28 |
| Isoelectric Point | 5.52 |
| Sequence | YQSGLSIVM |
Is the complex classified in the same cluster?