| Description | H-2 class I histocompatibility antigen, K-D alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | D |
| Length | 274 |
| Binding Area (Å2) | 822.35 |
| Molecular Weight | 31955.19 |
| Aromaticity | 0.14 |
| Instability | 38.78 |
| Isoelectric Point | 5.54 |
| Sequence | GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRW |
| Description | 10-mer peptide from Spike protein |
|---|---|
| Organism | Middle East respiratory syndrome-related coronavirus |
| Chain | F |
| Length | 10 |
| Binding Area (Å2) | 1242.62 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1137.28 |
| Aromaticity | 0.20 |
| Instability | 121.18 |
| Isoelectric Point | 4.00 |
| Sequence | FYAPEPITSL |
Is the complex classified in the same cluster?