| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | A |
| Length | 276 |
| Binding Area (Å2) | 655.68 |
| Molecular Weight | 32047.36 |
| Aromaticity | 0.12 |
| Instability | 41.81 |
| Isoelectric Point | 5.58 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP |
| Description | Pre-glycoprotein polyprotein GP complex |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | P |
| Length | 10 |
| Binding Area (Å2) | 1044.37 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1145.21 |
| Aromaticity | 0.10 |
| Instability | 52.94 |
| Isoelectric Point | 6.91 |
| Sequence | CSANNSHHYI |
Is the complex classified in the same cluster?