| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | G |
| Length | 267 |
| Binding Area (Å2) | 640.40 |
| Molecular Weight | 31080.29 |
| Aromaticity | 0.13 |
| Instability | 41.79 |
| Isoelectric Point | 5.82 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNARTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW |
| Description | GLYCOPROTEIN GPC |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | L |
| Length | 9 |
| Binding Area (Å2) | 1124.57 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 952.09 |
| Aromaticity | 0.11 |
| Instability | 4.16 |
| Isoelectric Point | 8.75 |
| Sequence | KGPSNFATM |
Is the complex classified in the same cluster?