| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | J |
| Length | 268 |
| Binding Area (Å2) | 690.84 |
| Molecular Weight | 31190.44 |
| Aromaticity | 0.13 |
| Instability | 42.17 |
| Isoelectric Point | 5.70 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLGEELMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP |
| Description | GLYCOPROTEIN G1 |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | L |
| Length | 9 |
| Binding Area (Å2) | 1124.81 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 966.11 |
| Aromaticity | 0.11 |
| Instability | 34.99 |
| Isoelectric Point | 8.75 |
| Sequence | KAPSNFATM |
Is the complex classified in the same cluster?