| Description | RT1 class I histocompatibility antigen, AA alpha chain, heavy chain |
|---|---|
| Organism | Rattus norvegicus |
| Chain | A |
| Length | 277 |
| Binding Area (Å2) | 637.06 |
| Molecular Weight | 32216.47 |
| Aromaticity | 0.12 |
| Instability | 35.83 |
| Isoelectric Point | 5.03 |
| Sequence | GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYWEQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDGRDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPL |
| Description | B6 Peptide |
|---|---|
| Organism | - |
| Chain | P |
| Length | 9 |
| Binding Area (Å2) | 1048.55 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 923.97 |
| Aromaticity | 0.11 |
| Instability | 21.91 |
| Isoelectric Point | 9.79 |
| Sequence | AQFSASASR |
Is the complex classified in the same cluster?