| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | J |
| Length | 276 |
| Binding Area (Å2) | 765.44 |
| Molecular Weight | 32047.36 |
| Aromaticity | 0.12 |
| Instability | 41.81 |
| Isoelectric Point | 5.58 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP |
| Description | Glycoprotein 9-residue peptide |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | L |
| Length | 9 |
| Binding Area (Å2) | 1215.30 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1058.25 |
| Aromaticity | 0.22 |
| Instability | -7.81 |
| Isoelectric Point | 8.59 |
| Sequence | KALYNFATM |
Is the complex classified in the same cluster?