| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | G |
| Length | 273 |
| Binding Area (Å2) | 646.09 |
| Molecular Weight | 31775.06 |
| Aromaticity | 0.12 |
| Instability | 41.14 |
| Isoelectric Point | 5.47 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP |
| Description | Pre-glycoprotein polyprotein GP complex |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | S |
| Length | 10 |
| Binding Area (Å2) | 1059.12 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1145.21 |
| Aromaticity | 0.10 |
| Instability | 52.94 |
| Isoelectric Point | 6.91 |
| Sequence | CSANNSHHYI |
Is the complex classified in the same cluster?