| Description | H-2 class I histocompatibility antigen, D-B alpha chain |
|---|---|
| Organism | Mus musculus |
| Chain | J |
| Length | 262 |
| Binding Area (Å2) | 718.42 |
| Molecular Weight | 30593.77 |
| Aromaticity | 0.13 |
| Instability | 42.16 |
| Isoelectric Point | 5.59 |
| Sequence | GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGLRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE |
| Description | GLYCOPROTEIN GPC |
|---|---|
| Organism | Lymphocytic choriomeningitis mammarenavirus |
| Chain | L |
| Length | 9 |
| Binding Area (Å2) | 1164.68 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1026.21 |
| Aromaticity | 0.22 |
| Instability | 34.99 |
| Isoelectric Point | 8.75 |
| Sequence | KAPFNFATM |
Is the complex classified in the same cluster?