| Description | Caltractin |
|---|---|
| Organism | Chlamydomonas reinhardtii |
| Chain | A |
| Length | 77 |
| Binding Area (Å2) | 768.01 |
| Molecular Weight | 8965.74 |
| Aromaticity | 0.05 |
| Instability | 52.61 |
| Isoelectric Point | 4.33 |
| Sequence | GSGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMKKTSLF |
| Description | Cell division control protein KAR1 |
|---|---|
| Organism | Saccharomyces cerevisiae |
| Chain | B |
| Length | 19 |
| Binding Area (Å2) | 851.61 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 2491.93 |
| Aromaticity | 0.11 |
| Instability | 67.89 |
| Isoelectric Point | 10.17 |
| Sequence | KKRELIESKWHRLLFHDKK |
Is the complex classified in the same cluster?