| Description | Retinoic acid receptor beta |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 240 |
| Binding Area (Å2) | 474.90 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 5.88 |
| Sequence | SYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMMEX |
| Description | Nuclear receptor coactivator 1 |
|---|---|
| Organism | Homo sapiens |
| Chain | F |
| Length | 9 |
| Binding Area (Å2) | 557.70 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1157.41 |
| Aromaticity | 0.00 |
| Instability | 83.39 |
| Isoelectric Point | 11.00 |
| Sequence | HKILHRLLQ |
Is the complex classified in the same cluster?