| Description | Estrogen receptor |
|---|---|
| Organism | Homo sapiens |
| Chain | B |
| Length | 243 |
| Binding Area (Å2) | 498.83 |
| Molecular Weight | - |
| Aromaticity | 0.06 |
| Instability | - |
| Isoelectric Point | 6.10 |
| Sequence | LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHX |
| Description | Nuclear receptor coactivator 2 |
|---|---|
| Organism | Mus musculus |
| Chain | D |
| Length | 11 |
| Binding Area (Å2) | 567.28 |
| Hydrophobic (% a.a.) |
|
| Molecular Weight | 1400.67 |
| Aromaticity | 0.00 |
| Instability | 87.55 |
| Isoelectric Point | 9.99 |
| Sequence | KHKILHRLLQD |
Is the complex classified in the same cluster?